RNASEL, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RNASEL, Each

$ 1,203.84
|
Details
This gene encodes a component of the interferon-regulated 2-5A system that functions in the antiviral and antiproliferative roles of interferons. Mutations in this gene have been associated with predisposition to prostate cancer and this gene is a candidate for the hereditary prostate cancer 1 (HPC1) allele. [provided by RefSeqSequence: HGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSI
Additional Information
SKU | 10292514 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB28675 |