518-831-8000 sales@utechproducts.com

RNF38, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RNF38, Each

1,148.40

Details

This gene encodes a protein with a coiled-coil motif and a RING-H2 motif (C3H2C2) at its carboxy-terminus. The RING motif is a zinc-binding domain found in a large set of proteins playing roles in diverse cellular processes including oncogenesis, development, signal transduction, and apoptosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: VVFSGQHLPVCSVPPPMLQACSVQHLPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPPGQFVPFQTQQSRSPLQRIENEVELLGEHLPVGGFTYPPSAHPPTLPPSAPL

Additional Information

SKU 10287126
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20851