RNF43, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RNF43, Each
$ 1,148.40
|
|
Details
RNF43 is a HAP95 (AKAP8L; MIM 609475) binding ubiquitin ligase that promotes cell growth and is upregulated in colon cancer (Yagyu et al., 2004 [PubMed 15492824]; Sugiura et al., 2008 [PubMed 18313049]).[supplied by OMIMSequence: CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSHLQSTSQH
Additional Information
| SKU | 10286741 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20409 |
