518-831-8000 sales@utechproducts.com

Rp5-1000e104 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Rp5-1000e10.4, Each

1,757.70

Details:

SIKE interacts with IKK-epsilon (IKBKE; MIM 605048) and TBK1 (MIM 604834) and acts as a suppressor of TLR3 (MIM 603029) and virus-triggered interferon activation pathways (Huang et al., 2005 [PubMed 16281057]).[supplied by OMIMSequence: AEPVLKAHQSHSAEIESQIDRICEMGEVMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMD

Additional Information

SKU 10287945
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21778