518-831-8000 sales@utechproducts.com

RP9, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RP9, Each

1,148.40

Details

The protein encoded by this gene can be bound and phosphorylated by the protooncogene PIM1 product, a serine/threonine protein kinase . This protein localizes in nuclear speckles containing the splicing factors, and has a role in pre-mRNA splicing. CBF1-interacting protein (CIR), a corepressor of CBF1, can also bind to this protein and effects alternative splicing. Mutations in this gene result in autosomal dominant retinitis pigmentosa-9. This gene has a pseudogene (GeneID: 441212), which is located in tandem array approximately 166kb distal to this gene. [provided by RefSeqSequence: PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWM

Additional Information

SKU 10288608
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22562