RRP15, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant RRP15, Each
$ 1,148.40
|
|
Details
This gene encodes a protein that co-purifies with human nucleoli. A similar protein in budding yeast is a component of pre-60S ribosomal particles, and is required for the early maturation steps of the 60S subunit. [provided by RefSeqSequence: VSEEENLKKTPKKKMKMVTGAVASVLEDEATDTSDSEGSCGSEKDHFYSDDDAIEADSEGDAEPCDKENENDGESSVGTN
Additional Information
| SKU | 10287897 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21727 |
Loading Cart Data 