SCRT1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SCRT1, Each

Details

This gene is a member of the Snail family of C2H2-type zinc finger transcription factors. It codes for a neural-specific transcriptional repressor that binds to E-box motifs. The protein may promote neural differention and may be involved in cancers with neuroendocrine features. [provided by RefSeqSequence: LHDKGYLSDYVGPSSVYDGDAEAALLKGPSPEPMYAAAVRGELGP