518-831-8000 sales@utechproducts.com

SEC14L1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SEC14L1, Each

1,203.84

Details

The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeqSequence: SVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQG

Additional Information

SKU 10288308
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22209