SEC14L1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SEC14L1, Each
$ 1,148.40
|
|
Details:
The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeqSequence: SVFKGAPHEILIQIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQLGRDYSMVESPLICKEGESVQG
Additional Information
| SKU | 10288308 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22209 |
