518-831-8000 sales@utechproducts.com

SEC24B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SEC24B, Each

1,203.84

Details

The protein encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The role of this gene product is implicated in the shaping of the vesicle, and also in cargo selection and concentration. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: SFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVR

Additional Information

SKU 10289184
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23235