518-831-8000 sales@utechproducts.com

SH3TC2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SH3TC2, Each

1,148.40

Details

This gene encodes a protein with two N-terminal Src homology 3 (SH3) domains and 10 tetratricopeptide repeat (TPR) motifs, and is a member of a small gene family. The gene product has been proposed to be an adapter or docking molecule. Mutations in this gene result in autosomal recessive Charcot-Marie-Tooth disease type 4C, a childhood-onset neurodegenerative disease characterized by demyelination of motor and sensory neurons. [provided by RefSeqSequence: SVLSFLYDKKYLPHLAVASVQQHGIQSAQGMSLPIWQVHLVLQNTTKLLGFPSPGWGEVSALACPMLRQALAACEELADRSTQRALCLILSKVYLEHRSPDGAIHYLSQ

Additional Information

SKU 10289109
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23149