SLAMF9 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLAMF9, Each

$ 1,160.00
|
Details
This gene encodes a member of the signaling lymphocytic activation molecule family. The encoded protein is a cell surface molecule that consists of two extracellular immunoglobulin domains, a transmembrane domain and a short cytoplasmic tail that lacks the signal transduction motifs found in other family members. Alternative splicing results in multiple transcript variantsSequence: TYSWLSRGDSTYTFHEGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAF
Additional Information
SKU | 10288863 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22856 |