SLC22A15, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC22A15, Each
$ 1,757.70
|
|
Details:
Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIMSequence: ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR
Additional Information
| SKU | 10287461 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21238 |
