Slc43a1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc43a1, Each
$ 1,757.70
|
|
Details:
SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]).[supplied by OMIMSequence: MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQ
Additional Information
| SKU | 10287288 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21045 |
Loading Cart Data 