518-831-8000 sales@utechproducts.com

SLC6A14, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC6A14, Each

1,148.40

Details:

SLC6A14 is a member of the Na( )- and Cl(-)-dependent neurotransmitter transporter family and transports both neutral and cationic amino acids in an Na( )- and Cl(-)-dependent manner.[supplied by OMIMSequence: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG

Additional Information

SKU 10286540
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20176