Slc6a14, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc6a14, Each
$ 1,757.70
|
|
Details:
SLC6A14 is a member of the Na( )- and Cl(-)-dependent neurotransmitter transporter family and transports both neutral and cationic amino acids in an Na( )- and Cl(-)-dependent manner.[supplied by OMIMSequence: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG
Additional Information
| SKU | 10286540 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20176 |
