SLC7A3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC7A3, Each
$ 1,415.20
|
|
Details
SLC7A3 is a member of the system y family of transporters characterized by sodium-independent transport of cationic amino acids.[supplied by OMIMSequence: RYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQI
Additional Information
| SKU | 10286592 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20231 |
Loading Cart Data 