Slc9a3r2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc9a3r2, Each
$ 1,750.95
|
|
Details:
NHE3 (SLC9A3; MIM 182307) is a sodium/hydrogen exchanger in the brush border membrane of the proximal tubule, small intestine, and colon that plays a major role in transepithelial sodium absorption. SLC9A3R2, as well as SLC9A3R1 (MIM 604990) and protein kinase A phosphorylation, may play a role in NHE3 regulation.[supplied by OMIMSequence: RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH
Additional Information
| SKU | 10286449 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20079 |
