518-831-8000 sales@utechproducts.com

SMARCD1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SMARCD1, Each

1,203.84

Details

The protein encoded by this gene is a member of the SWI/SNF family of proteins, whose members display helicase and ATPase activities and which are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI and has sequence similarity to the yeast Swp73 protein. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: MGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRNHNAKK

Additional Information

SKU 10286617
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20261