518-831-8000 sales@utechproducts.com

Snrpd3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Snrpd3, Each

1,750.95

Details:

The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. [provided by RefSeqSequence: KVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNI

Additional Information

SKU 10286411
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20038