518-831-8000 sales@utechproducts.com

SPAG16, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SPAG16, Each

1,203.84

Details

Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. SPAG16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (Zhang et al., 2007 [PubMed 17699735]).[supplied by OMIMSequence: NLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKLINDLKGLKLHYASYEPTIRVLHEKHHTLLKEKMLTSLERDKVVG

Additional Information

SKU 10289090
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23127