518-831-8000 sales@utechproducts.com

SPAG9 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SPAG9, Each

1,160.00

Details

Extracellular signals are transduced into cells through mitogen-activated protein kinases. The structural organization of these kinases into specific signaling domains is facilitated by scaffolding proteins involved in closely tethering different kinases so that successive phosphorylation events can occur. The protein encoded by this gene is a scaffolding protein that brings together mitogen-activated protein kinases and their transcription factor targets for the activation of specific signaling pathways. This gene which is abundantly expressed in testicular haploid germ cells encodes a protein that is recognized by sperm-agglutinating antibodies and implicated in infertility. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: SGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAATSPSTNGASPVMDKPPEMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQIPEDLSPVYQSSN

Additional Information

SKU 10289399
UOM Each
UNSPSC 12161500
Manufacturer Part Number PAB23483
CAS Number 64-17-5
HS Code 2207100000
UN Number UN 1170
Proper Shipping Name Ethanol
Packaging Group PG II
Commodity Code 526, 527
DG or HZ DG
Hazardous Class 3
Label
Molecular Formula C2H6O
EC Number 200-578-6
HIN 33
Hazard Statement H225-H319
Precautionary Statements P280a-P303+P361+P353-P405-P501a-P210-P280-P305+P351+P338-P337+P313-P403+P235-P370+P378-P308+P311-P260-P301+P310-P311
Risk Statements 11-10-36/37/38-39/23/24/25-23/24/25-68/20/21/22-20/21/22-52/53-51/53
GHS GHS02,GHS07
GHS (Pictogram)
Safety Statements 16-7-36-26-45-36/37-61-24/25-2017/7/16
Hazard Code F,T,Xn,N
Signal Word Danger