518-831-8000 sales@utechproducts.com

SPANXN4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SPANXN4, Each

1,148.40

Details:

This gene represents one of several duplicated family members that are located on the X chromosome. This gene family encodes proteins that play a role in spermiogenesis. These proteins represent a specific subgroup of cancer/testis-associated antigens, and they may be candidates for tumor vaccines. This family member belongs to a subgroup of related genes that are present in all primates and rats and mice, and thus, it represents one of the ancestral family members. [provided by RefSeqSequence: KEKGDLDISAGSPQDGEEEKDLVFLGARACLEEHIRRSVLYVGDSDTLSKMKTSESPPSGHIPQSGVFCNSPNAV

Additional Information

SKU 10290116
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24443