STT3B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant STT3B, Each

$ 1,148.40
|
Details
The SIMP protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, B6(dom1). Like ITM1 (MIM 601134), SIMP is homologous to yeast STT3, an oligosaccharyltransferase essential for cell proliferation (McBride et al., 2002 [PubMed 12439619]).[supplied by OMIMSequence: NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP
Additional Information
SKU | 10289018 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB23044 |