SYF2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SYF2, Each
$ 1,148.40
|
|
Details:
This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeqSequence: AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARG
Additional Information
| SKU | 10292011 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28017 |
Loading Cart Data 