SYT13, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SYT13, Each
$ 1,203.84
|
|
Details
SYT13 belongs to the large synaptotagmin protein family. All synaptotagmins show type I membrane topology, with an extracellular N terminus, a single transmembrane region, and a cytoplasmic C terminus containing tandem C2 domains. Major functions of synaptotagmins include vesicular traffic, exocytosis, and secretion.[supplied by OMIMSequence: TLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKE
Additional Information
| SKU | 10290156 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24486 |
Loading Cart Data 