TAF4B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TAF4B, Each
$ 1,148.40
|
|
Details:
TATA-binding protein associated factors (TAFs) participate, with TATA binding protein (TBP; MIM 600075), in the formation of the TFIID protein complex (see MIM 313650), which is involved in the initiation of gene transcription by RNA polymerase II (see MIM 180660).[supplied by OMIMSequence: PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT
Additional Information
| SKU | 10288325 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22229 |
