TAF7L, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TAF7L, Each
$ 1,148.40
|
|
Details:
This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. [provided by RefSeqSequence: ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRK
Additional Information
| SKU | 10292382 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28528 |
Loading Cart Data 