518-831-8000 sales@utechproducts.com

TFAP4, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TFAP4, Each

1,203.84

Details

Transcription factors of the basic helix-loop-helix-zipper (bHLH-ZIP) family contain a basic domain, which is used for DNA binding, and HLH and ZIP domains, which are used for oligomerization. Transcription factor AP4 activates both viral and cellular genes by binding to the symmetrical DNA sequence CAGCTG (Mermod et al., 1988 [PubMed 2833704]; Hu et al., 1990 [PubMed 2123466]).[supplied by OMIMSequence: YFMVPTQKVPSLQHFRKTEKEVIGGLCSLANIPLTPETQRDQERRIRREIANSNERRRMQSINAGFQSLKTLIPHTDGEKLSKAAILQQTAEYIFSLEQEKTRLLQQNTQLKRFIQELSGSSPKRRRAEDKDEGIGSPDIWEDEK

Additional Information

SKU 10292389
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28535