518-831-8000 sales@utechproducts.com

TNFSF12-TNFSF13, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TNFSF12-TNFSF13, Each

1,148.40

Details:

This gene encodes a member of the tumor necrosis factor superfamily. It encodes a hybrid protein composed of the cytoplasmic and transmembrane domains of family member 12 fused to the C-terminal domain of family member 13. The hybrid protein is membrane anchored and presents the receptor-binding domain of family member 13 at the cell surface. It stimulates cycling in T- and B-lymphoma cell lines. [provided by RefSeqSequence: LEAWENGERSRKRRAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILS

Additional Information

SKU 10292132
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28217