TOMM22, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TOMM22, Each
$ 1,097.65
|
|
Details:
The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion. [provided by RefSeqSequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
Additional Information
| SKU | 10292479 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28636 |
Loading Cart Data 