518-831-8000 sales@utechproducts.com

TOX3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TOX3, Each

1,148.40

Details

The protein encoded by this gene contains an HMG-box, indicating that it may be involved in bending and unwinding of DNA and alteration of chromatin structure. The C-terminus of the encoded protein is glutamine-rich due to CAG repeats in the coding sequence. A minor allele of this gene has been implicated in an elevated risk of breast cancer. Two transcript variants encoding different isoforms have been found for this geneSequence: SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP

Additional Information

SKU 10289549
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23652