TPCN2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TPCN2, Each
$ 1,148.40
|
|
Details
TPCN2 is a putative cation-selective ion channel related to CATSPER (see CATSPER1; MIM 606389) and transient receptor potential channels (see TRPC1; MIM 602343) (Clapham and Garbers, 2005 [PubMed 16382101]).[supplied by OMIMSequence: QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYF
Additional Information
| SKU | 10288133 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22001 |
Loading Cart Data 