518-831-8000 sales@utechproducts.com

TPCN2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TPCN2, Each

1,148.40

Details

TPCN2 is a putative cation-selective ion channel related to CATSPER (see CATSPER1; MIM 606389) and transient receptor potential channels (see TRPC1; MIM 602343) (Clapham and Garbers, 2005 [PubMed 16382101]).[supplied by OMIMSequence: QFRGYLMKSLQTSLFRRRLGTRAAFEVLSSMVGEGGAFPQAVGVKPQNLLQVLQKVQLDSSHRQAMMEKVRSYGSVLLSAEEFQKLFNELDRSVVKEHPPRPEYQSPFLQSAQFLFGHYYF

Additional Information

SKU 10288133
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22001