518-831-8000 sales@utechproducts.com

TSPAN3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TSPAN3, Each

1,148.40

Details

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. Two alternative transcripts encoding different isoforms have been described. [provided by RefSeqSequence: NGTNPDAASRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEALVVKKLQEI

Additional Information

SKU 10287138
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20863