TTLL5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TTLL5, Each
$ 1,160.00
|
|
Details:
TTLL5 is a glucocorticoid receptor (GCCR; MIM 138040) coregulator that interacts with coactivators TIF2 (NCOA2; MIM 601993) and SRC1 (NCOA1; MIM 602691) (He and Simons, 2007 [PubMed 17116691]).[supplied by OMIMSequence: NKHHSGIAKTQKEGEDASLYSKRYNQSMVTAELQRLAEKQAARQYSPSSHINLLTQQVTNLNLATGIINRSSASAPPTLRPIISPSGP
Additional Information
| SKU | 10288658 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22614 |
Loading Cart Data 