UNC13A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UNC13A, Each
$ 1,457.25
|
|
Details:
Proteins of the UNC13 family, such as UNC13A, are diacylglycerol and phorbol ester receptors with ligand affinities similar to those of protein kinase C (see PRKCA; MIM 176960). Rodent Unc13a is a presynaptic protein with an essential role in synaptic vesicle priming (Rossner et al., 2004 [PubMed 15123597]).[supplied by OMIMSequence: QLSEDFDPDEHSLQGSDMEDERDRDSYHSCHSSVSYHKDSPRWDQDEEELEEDLEDFLEEEE
Additional Information
| SKU | 10282391 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23802 |
