518-831-8000 sales@utechproducts.com

UQCRB, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UQCRB, Each

1,148.40

Details:

This gene encodes a protein which is part of the ubiquinol-cytochrome c oxidoreductase complex which contains ten nuclear-encoded and one mitochondrial-encoded subunits. The encoded protein binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. Mutations in this gene are associated with mitochondrial complex III deficiency. A pseudogene has been described on the X chromosome. [provided by RefSeqSequence: LPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK

Additional Information

SKU 10289864
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24004