UQCRQ, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UQCRQ, Each
$ 1,447.10
|
|
Details:
This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain. [provided by RefSeqSequence: REFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRR
Additional Information
| SKU | 10290176 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB24512 |
