UST, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant UST, Each
$ 1,148.40
|
|
Details:
Uronyl 2-sulfotransferase transfers sulfate to the 2-position of uronyl residues, such as iduronyl residues in dermatan sulfate and glucuronyl residues in chondroitin sulfate (Kobayashi et al., 1999 [PubMed 10187838]).[supplied by OMIMSequence: YNRVGKCGSRTVVLLLRILSEKHGFNLVTSDIHNKTRLTKNEQMELIKNISTAEQPYLFTRHVHFLNFSRFG
Additional Information
| SKU | 10288647 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22603 |
Loading Cart Data 