518-831-8000 sales@utechproducts.com

VPREB3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant VPREB3, Each

1,203.84

Details

The protein encoded by this gene is the human homolog of the mouse VpreB3 (8HS20) protein, and is specifically expressed in cell lines representative of all stages of B-cell differentiation. It is also related to VPREB1 and other members of the immunoglobulin supergene family. This protein associates with membrane mu heavy chains early in the course of pre-B cell receptor biosynthesis. The precise function of the protein is not known, but it may contribute to mu chain transport in pre-B cells. [provided by RefSeqSequence: QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP

Additional Information

SKU 10292480
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28637