VTA1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant VTA1, Each

$ 1,203.84
|
Details
C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]).[supplied by OMIMSequence: FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA
Additional Information
SKU | 10288555 |
---|---|
UOM | Each |
UNSPSC | 12352203 |
Manufacturer Part Number | PAB22500 |