518-831-8000 sales@utechproducts.com

XKR3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant XKR3, Each

1,148.40

Details

XKRX (MIM 300684) and XKR3 are homologs of the Kell blood group precursor XK (MIM 314850), which is a putative membrane transporter and a component of the XK/Kell complex of the Kell blood group system (Calenda et al., 2006 [PubMed 16431037]).[supplied by OMIMSequence: TIRNYHKWLKNLKQEKEETQVSITKRNTMLEREIAFSIRDNFMQQKAFK

Additional Information

SKU 10288058
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21910