518-831-8000 sales@utechproducts.com

ZDHHC15, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ZDHHC15, Each

1,148.40

Details

The protein encoded by this gene belongs to the DHHC palmitoyltransferase family. Mutations in this gene are associated with mental retardatio X-linked type 91 (MRX91). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: VSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEETWEDNEDDNQ

Additional Information

SKU 10287329
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21089